TTLL10 polyclonal antibody
  • TTLL10 polyclonal antibody

TTLL10 polyclonal antibody

Ref: AB-PAB23970
TTLL10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TTLL10.
Información adicional
Size 100 uL
Gene Name TTLL10
Gene Alias FLJ36119|FLJ42131|TTLL5
Gene Description tubulin tyrosine ligase-like family, member 10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KPTASNQGKGIFLLRNQEEVAALQAKTRSMEDDPIHHKTPFRGPQARVVQRYIQNPLLVDGRKFDVRSYLLIACTTPYMIFFGHGYARLTLSLYDPHSSDLG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TTLL10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 254173
Iso type IgG

Enviar uma mensagem


TTLL10 polyclonal antibody

TTLL10 polyclonal antibody