ANKRD39 polyclonal antibody
  • ANKRD39 polyclonal antibody

ANKRD39 polyclonal antibody

Ref: AB-PAB23967
ANKRD39 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKRD39.
Información adicional
Size 100 uL
Gene Name ANKRD39
Gene Alias MGC41816
Gene Description ankyrin repeat domain 39
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq RVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRASYCGHTE
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKRD39.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51239
Iso type IgG

Enviar uma mensagem


ANKRD39 polyclonal antibody

ANKRD39 polyclonal antibody