CRIP2 polyclonal antibody
  • CRIP2 polyclonal antibody

CRIP2 polyclonal antibody

Ref: AB-PAB23964
CRIP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CRIP2.
Información adicional
Size 100 uL
Gene Name CRIP2
Gene Alias CRIP|CRP2|ESP1
Gene Description cysteine-rich protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAE
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CRIP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1397
Iso type IgG

Enviar uma mensagem


CRIP2 polyclonal antibody

CRIP2 polyclonal antibody