TCHHL1 polyclonal antibody
  • TCHHL1 polyclonal antibody

TCHHL1 polyclonal antibody

Ref: AB-PAB23957
TCHHL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TCHHL1.
Información adicional
Size 100 uL
Gene Name TCHHL1
Gene Alias S100A17|THHL1|basalin
Gene Description trichohyalin-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KHSNIQEPPLQREDEPSSQHADLPEQAAARSPSQTQKSTDSKDVCRMFDTQEPGKDADQTPAKTKNLGEPEDYGRTSETQEKECETKDLPVQYGSRN
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TCHHL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 126637
Iso type IgG

Enviar uma mensagem


TCHHL1 polyclonal antibody

TCHHL1 polyclonal antibody