C19orf29 polyclonal antibody
  • C19orf29 polyclonal antibody

C19orf29 polyclonal antibody

Ref: AB-PAB23947
C19orf29 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C19orf29.
Información adicional
Size 100 uL
Gene Name C19orf29
Gene Alias NY-REN-24|cactin|fSAPc
Gene Description chromosome 19 open reading frame 29
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TGFEWNKYNQTHYDFDNPPPKIVQGYKFNIFYPDLIDKRSTPEYFLEACADNKDFAILRFHAGPPYEDIAFKIVNREWEYSHRHGFRCQFANGIFQLWFH
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C19orf29.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 58509
Iso type IgG

Enviar uma mensagem


C19orf29 polyclonal antibody

C19orf29 polyclonal antibody