CLRN2 polyclonal antibody
  • CLRN2 polyclonal antibody

CLRN2 polyclonal antibody

Ref: AB-PAB23939
CLRN2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CLRN2.
Información adicional
Size 100 uL
Gene Name CLRN2
Gene Alias -
Gene Description clarin 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VKFHDLTERIANFQEKLFQFVVVEEQYEES
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CLRN2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 645104
Iso type IgG

Enviar uma mensagem


CLRN2 polyclonal antibody

CLRN2 polyclonal antibody