TMEM111 polyclonal antibody
  • TMEM111 polyclonal antibody

TMEM111 polyclonal antibody

Ref: AB-PAB23932
TMEM111 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM111.
Información adicional
Size 100 uL
Gene Name TMEM111
Gene Alias POB
Gene Description transmembrane protein 111
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QVSDSQVLIRSRVLRENGKYIPKQSFLTRKYYFNNPEDGFFKKTKRKVVPPSPMTDPTM
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM111.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55831
Iso type IgG

Enviar uma mensagem


TMEM111 polyclonal antibody

TMEM111 polyclonal antibody