C12orf23 polyclonal antibody
  • C12orf23 polyclonal antibody

C12orf23 polyclonal antibody

Ref: AB-PAB23927
C12orf23 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C12orf23.
Información adicional
Size 100 uL
Gene Name C12orf23
Gene Alias FLJ11721|FLJ13959|MGC17943
Gene Description chromosome 12 open reading frame 23
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QQEIPSYLNDEPPEGSMKDHPQQQPGMLSR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C12orf23.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 90488
Iso type IgG

Enviar uma mensagem


C12orf23 polyclonal antibody

C12orf23 polyclonal antibody