SMCR7 polyclonal antibody
  • SMCR7 polyclonal antibody

SMCR7 polyclonal antibody

Ref: AB-PAB23926
SMCR7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SMCR7.
Información adicional
Size 100 uL
Gene Name SMCR7
Gene Alias MGC23130
Gene Description Smith-Magenis syndrome chromosome region, candidate 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PPAALSQPVLPLAPSSSAPEGPAETDPEVTPQLSSPAPLCLTLQERLLAFERDRVTIPAAQVALAKQLAGDIALELQAYFRSKFPELPFGAFVPGGPLYDGLQAGAADHVRLL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SMCR7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 125170
Iso type IgG

Enviar uma mensagem


SMCR7 polyclonal antibody

SMCR7 polyclonal antibody