SUSD3 polyclonal antibody
  • SUSD3 polyclonal antibody

SUSD3 polyclonal antibody

Ref: AB-PAB23923
SUSD3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SUSD3.
Información adicional
Size 100 uL
Gene Name SUSD3
Gene Alias MGC26847
Gene Description sushi domain containing 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEWSSGSPVCKLVPPHETFGFKVA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SUSD3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 203328
Iso type IgG

Enviar uma mensagem


SUSD3 polyclonal antibody

SUSD3 polyclonal antibody