CENPE polyclonal antibody
  • CENPE polyclonal antibody

CENPE polyclonal antibody

Ref: AB-PAB23920
CENPE polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CENPE.
Información adicional
Size 100 uL
Gene Name CENPE
Gene Alias KIF10
Gene Description centromere protein E, 312kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq EKIENLTRMLVTSSSLTLQQELKAKRKRRVTWCLGKINKMKNSNYADQFNIPTNITTKTHKLSINLLREIDESVCSESDVFSNTLDTLSEIEWNPATKLLNQENIESELNSLRADYDN
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CENPE.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1062
Iso type IgG

Enviar uma mensagem


CENPE polyclonal antibody

CENPE polyclonal antibody