IL20RA polyclonal antibody
  • IL20RA polyclonal antibody

IL20RA polyclonal antibody

Ref: AB-PAB23918
IL20RA polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IL20RA.
Información adicional
Size 100 uL
Gene Name IL20RA
Gene Alias FLJ40993|IL-20R1|ZCYTOR7
Gene Description interleukin 20 receptor, alpha
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IL20RA.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 53832
Iso type IgG

Enviar uma mensagem


IL20RA polyclonal antibody

IL20RA polyclonal antibody