RP1 polyclonal antibody
  • RP1 polyclonal antibody

RP1 polyclonal antibody

Ref: AB-PAB23915
RP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RP1.
Información adicional
Size 100 uL
Gene Name RP1
Gene Alias DCDC4A|ORP1
Gene Description retinitis pigmentosa 1 (autosomal dominant)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VTCSPCEMCTVNKAYSPKETCNPSDTFFPSDGYGVDQTSMNKACFLGEVCSLTDTVFSDKACAQKENHTYEGACPIDETYVPVNVCNTIDFLNSKENTYTDNLDSTEELERGDDIQKDLNILTDPEYKNGFNTLVSHQNVSNLSSCG
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6101
Iso type IgG

Enviar uma mensagem


RP1 polyclonal antibody

RP1 polyclonal antibody