REXO1 polyclonal antibody
  • REXO1 polyclonal antibody

REXO1 polyclonal antibody

Ref: AB-PAB23909
REXO1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant REXO1.
Información adicional
Size 100 uL
Gene Name REXO1
Gene Alias ELOABP1|EloA-BP1|KIAA1138|REX1|TCEB3BP1
Gene Description REX1, RNA exonuclease 1 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PSGKYVVDNSRPPTDLEYDPLSNYSARHLSRASSRDERAAKRPRGSRGSEPYTPAPKKLCDPFGSCDARFSDSEDEAATVPGNEPTT
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human REXO1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57455
Iso type IgG

Enviar uma mensagem


REXO1 polyclonal antibody

REXO1 polyclonal antibody