RSBN1 polyclonal antibody
  • RSBN1 polyclonal antibody

RSBN1 polyclonal antibody

Ref: AB-PAB23905
RSBN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RSBN1.
Información adicional
Size 100 uL
Gene Name RSBN1
Gene Alias DKFZp781E21150|ROSBIN|RP11-324J2.1
Gene Description round spermatid basic protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KEILTQGQINSTSGLNKESFRYLKDEQLCRLNLGMQEYRVPQGVQTPFMTHQEHSIRRNFLKTGTKFSNFIHEEHQSNGGALV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RSBN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54665
Iso type IgG

Enviar uma mensagem


RSBN1 polyclonal antibody

RSBN1 polyclonal antibody