ZSWIM4 polyclonal antibody
  • ZSWIM4 polyclonal antibody

ZSWIM4 polyclonal antibody

Ref: AB-PAB23900
ZSWIM4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZSWIM4.
Información adicional
Size 100 uL
Gene Name ZSWIM4
Gene Alias -
Gene Description zinc finger, SWIM-type containing 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PLDPIGCLCRALLEACRLEEETLTLYPDSGPEKRKVAYQHVPVPGSPGESYLVL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZSWIM4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 65249
Iso type IgG

Enviar uma mensagem


ZSWIM4 polyclonal antibody

ZSWIM4 polyclonal antibody