SYCE2 polyclonal antibody
  • SYCE2 polyclonal antibody

SYCE2 polyclonal antibody

Ref: AB-PAB23897
SYCE2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SYCE2.
Información adicional
Size 100 uL
Gene Name SYCE2
Gene Alias CESC1
Gene Description synaptonemal complex central element protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IDILQKRAQELIENINKSRQKDHALMTNFRNSLKTKVSDLTEKLEERIYQIYNDHNKIIQEKLQEFTQK
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SYCE2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 256126
Iso type IgG

Enviar uma mensagem


SYCE2 polyclonal antibody

SYCE2 polyclonal antibody