SIX5 polyclonal antibody
  • SIX5 polyclonal antibody

SIX5 polyclonal antibody

Ref: AB-PAB23896
SIX5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SIX5.
Información adicional
Size 100 uL
Gene Name SIX5
Gene Alias BOR2|DMAHP
Gene Description SIX homeobox 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq VVPTSQVVTLPQAVGPLQLLAAGPGSPVKVAAAAGPANVHLINSGVGVTALQLPSATAPGNFLLANPVSGSPIVTGVAVQQGKIILTATFPTSMLVSQVLP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SIX5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 147912
Iso type IgG

Enviar uma mensagem


SIX5 polyclonal antibody

SIX5 polyclonal antibody