TMC5 polyclonal antibody
  • TMC5 polyclonal antibody

TMC5 polyclonal antibody

Ref: AB-PAB23892
TMC5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMC5.
Información adicional
Size 100 uL
Gene Name TMC5
Gene Alias FLJ13593
Gene Description transmembrane channel-like 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq STWREPDYSDAENGHDYGSSETPKMTRGVLSRTSSIQPSFRHRSDDPVGSLWGENDYPEGIEMASMEMANSYGHSLPGAPGSGYVNPAYVGESGPVH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMC5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79838
Iso type IgG

Enviar uma mensagem


TMC5 polyclonal antibody

TMC5 polyclonal antibody