C15orf23 polyclonal antibody
  • C15orf23 polyclonal antibody

C15orf23 polyclonal antibody

Ref: AB-PAB23891
C15orf23 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C15orf23.
Información adicional
Size 100 uL
Gene Name C15orf23
Gene Alias FLJ14502|HSD11|MGC141728|MGC141729|TRAF4AF1
Gene Description chromosome 15 open reading frame 23
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TVYSLQPPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITKLRRENGQMKATDTATRRNVRKGYKPLSKQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C15orf23.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 90417
Iso type IgG

Enviar uma mensagem


C15orf23 polyclonal antibody

C15orf23 polyclonal antibody