C19orf48 polyclonal antibody
  • C19orf48 polyclonal antibody

C19orf48 polyclonal antibody

Ref: AB-PAB23887
C19orf48 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C19orf48.
Información adicional
Size 100 uL
Gene Name C19orf48
Gene Alias MGC13170
Gene Description chromosome 19 open reading frame 48
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPR
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C19orf48.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84798
Iso type IgG

Enviar uma mensagem


C19orf48 polyclonal antibody

C19orf48 polyclonal antibody