HEATR3 polyclonal antibody
  • HEATR3 polyclonal antibody

HEATR3 polyclonal antibody

Ref: AB-PAB23885
HEATR3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HEATR3.
Información adicional
Size 100 uL
Gene Name HEATR3
Gene Alias FLJ20718
Gene Description HEAT repeat containing 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CFLLEVTTKDPSLVVAGEALDALFDVFADGKEAERASIQIKLLSALKEFQPVFKMKIRKEGRGNYSTDQLCVLDNVKMNLRRFIAYQETVEKRL
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HEATR3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55027
Iso type IgG

Enviar uma mensagem


HEATR3 polyclonal antibody

HEATR3 polyclonal antibody