RTTN polyclonal antibody
  • RTTN polyclonal antibody

RTTN polyclonal antibody

Ref: AB-PAB23883
RTTN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RTTN.
Información adicional
Size 100 uL
Gene Name RTTN
Gene Alias DKFZp434G145|FLJ26356|FLJ39085
Gene Description rotatin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SEEGADTKRPLIDARVLSRVTDLFIGKKPIELRLDDRRELVIKLETVEKVYEIFTSDDVDLVLGKSAAEQLAVIMQDIKMHAVVKKLCLIDKIIEYLNECVSQDGKVV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RTTN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25914
Iso type IgG

Enviar uma mensagem


RTTN polyclonal antibody

RTTN polyclonal antibody