KCTD21 polyclonal antibody
  • KCTD21 polyclonal antibody

KCTD21 polyclonal antibody

Ref: AB-PAB23882
KCTD21 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KCTD21.
Información adicional
Size 100 uL
Gene Name KCTD21
Gene Alias -
Gene Description potassium channel tetramerisation domain containing 21
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EKNAMLNITLNQRVQTVHFTVREAPQIYSLSSSSMEVFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KCTD21.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 283219
Iso type IgG

Enviar uma mensagem


KCTD21 polyclonal antibody

KCTD21 polyclonal antibody