FAM103A1 polyclonal antibody
  • FAM103A1 polyclonal antibody

FAM103A1 polyclonal antibody

Ref: AB-PAB23881
FAM103A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM103A1.
Información adicional
Size 100 uL
Gene Name FAM103A1
Gene Alias C15orf18|HsT19360|MGC102778|MGC2560
Gene Description family with sequence similarity 103, member A1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MTDTAEAVPKFEEMFASRFTENDKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNRLQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM103A1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83640
Iso type IgG

Enviar uma mensagem


FAM103A1 polyclonal antibody

FAM103A1 polyclonal antibody