C15orf53 polyclonal antibody
  • C15orf53 polyclonal antibody

C15orf53 polyclonal antibody

Ref: AB-PAB23875
C15orf53 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C15orf53.
Información adicional
Size 100 uL
Gene Name C15orf53
Gene Alias FLJ35695|MGC148119
Gene Description chromosome 15 open reading frame 53
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QEDLGISLSSPRRNHETRPGSKAKGRSSICLQASVWMAGGKLRLRASEHLTQGHQQELRDWNLGEDASLLFSKSPFGAGKL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C15orf53.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 400359
Iso type IgG

Enviar uma mensagem


C15orf53 polyclonal antibody

C15orf53 polyclonal antibody