PDILT polyclonal antibody
  • PDILT polyclonal antibody

PDILT polyclonal antibody

Ref: AB-PAB23874
PDILT polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PDILT.
Información adicional
Size 100 uL
Gene Name PDILT
Gene Alias -
Gene Description protein disulfide isomerase-like protein of the testis
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VSSIHITKPVHILEERSLLVLTPAGLTQMLNQTRFLMVLFHNPSSKQSRNLAEELGKAVEIMGKGKNGIGFGKVDITIEKELQQEFGI
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PDILT.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 204474
Iso type IgG

Enviar uma mensagem


PDILT polyclonal antibody

PDILT polyclonal antibody