DDX28 polyclonal antibody
  • DDX28 polyclonal antibody

DDX28 polyclonal antibody

Ref: AB-PAB23873
DDX28 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DDX28.
Información adicional
Size 100 uL
Gene Name DDX28
Gene Alias FLJ11282|MDDX28
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 28
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq TLLDESFLELVDYILEKSHIAEGPADLEDPFNPKAQLVLVGATFPEGVGQLLNKVASPDAVTTITSSKLHCIMPHVKQTFLRLKGADK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DDX28.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55794
Iso type IgG

Enviar uma mensagem


DDX28 polyclonal antibody

DDX28 polyclonal antibody