CILP2 polyclonal antibody
  • CILP2 polyclonal antibody

CILP2 polyclonal antibody

Ref: AB-PAB23863
CILP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CILP2.
Información adicional
Size 100 uL
Gene Name CILP2
Gene Alias CLIP-2|MGC45771
Gene Description cartilage intermediate layer protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LRFARILLGQEPIGFTAYQGDFTIEVPPSTQRLVVTFVDPSGEFMDAVRVLPFDPRGAGVYHEVKAMRKKAPVILHTSQSNTIPLGELEDEAPLGELVLPSGAFRRADGKPYSGP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CILP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 148113
Iso type IgG

Enviar uma mensagem


CILP2 polyclonal antibody

CILP2 polyclonal antibody