TSSC4 polyclonal antibody
  • TSSC4 polyclonal antibody

TSSC4 polyclonal antibody

Ref: AB-PAB23855
TSSC4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TSSC4.
Información adicional
Size 100 uL
Gene Name TSSC4
Gene Alias -
Gene Description tumor suppressing subtransferable candidate 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TKYSLEDVTEVSEQSNQATALAFLGSQSLAAPTDCVSSFNQDPSSCGEGRVIFTKPVRGVEARHERKRVLGKVGEPGRGGLGNPATD
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TSSC4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10078
Iso type IgG

Enviar uma mensagem


TSSC4 polyclonal antibody

TSSC4 polyclonal antibody