SLC38A7 polyclonal antibody
  • SLC38A7 polyclonal antibody

SLC38A7 polyclonal antibody

Ref: AB-PAB23852
SLC38A7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC38A7.
Información adicional
Size 100 uL
Gene Name SLC38A7
Gene Alias FLJ10815|FLJ12724
Gene Description solute carrier family 38, member 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MAQVSINNDYSEWDLSTDAGERARLLQSPCVDTAPKSEWEASPGGLDRGTTST
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC38A7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55238
Iso type IgG

Enviar uma mensagem


SLC38A7 polyclonal antibody

SLC38A7 polyclonal antibody