CRAMP1L polyclonal antibody
  • CRAMP1L polyclonal antibody

CRAMP1L polyclonal antibody

Ref: AB-PAB23851
CRAMP1L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CRAMP1L.
Información adicional
Size 100 uL
Gene Name CRAMP1L
Gene Alias HN1L|MGC176736|TCE4
Gene Description Crm, cramped-like (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LRNPPRPLLVPGPSSTGSNDSDGGLFAVPTTLPPNSRHGKLFSPSKEAELTFRQHLNSISMQSDFFLPKPRKLRNRHLRKPLVVQRTLLPRPSENQSHN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CRAMP1L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57585
Iso type IgG

Enviar uma mensagem


CRAMP1L polyclonal antibody

CRAMP1L polyclonal antibody