CLC polyclonal antibody
  • CLC polyclonal antibody

CLC polyclonal antibody

Ref: AB-PAB23850
CLC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CLC.
Información adicional
Size 100 uL
Gene Name CLC
Gene Alias LGALS10|LPPL_HUMAN|MGC149659
Gene Description Charcot-Leyden crystal protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVM
Form Liquid
Recomended Dilution Immunohistochemistry (1:2500-1:5000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CLC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1178
Iso type IgG

Enviar uma mensagem


CLC polyclonal antibody

CLC polyclonal antibody