CCDC15 polyclonal antibody
  • CCDC15 polyclonal antibody

CCDC15 polyclonal antibody

Ref: AB-PAB23848
CCDC15 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC15.
Información adicional
Size 100 uL
Gene Name CCDC15
Gene Alias FLJ13215
Gene Description coiled-coil domain containing 15
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QQPASFMREERVREELPLDYHQYVVPKIQDQDSPREQNKHIKLPSSFEKWEIARGNTPGVPLAYDRYQSGLSTEFQAPLAFQSDVDKEEDKKERQKQYLR
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC15.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80071
Iso type IgG

Enviar uma mensagem


CCDC15 polyclonal antibody

CCDC15 polyclonal antibody