NPVF polyclonal antibody
  • NPVF polyclonal antibody

NPVF polyclonal antibody

Ref: AB-PAB23846
NPVF polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NPVF.
Información adicional
Size 100 uL
Gene Name NPVF
Gene Alias C7orf9|RFRP
Gene Description neuropeptide VF precursor
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TANLPLRSGRNMEVSLVRRVPNLPQRFGRTTTAKSVCRMLSDLCQGSMHSPCANDLFYSMTCQHQEIQNPDQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NPVF.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64111
Iso type IgG

Enviar uma mensagem


NPVF polyclonal antibody

NPVF polyclonal antibody