TRAPPC2L polyclonal antibody
  • TRAPPC2L polyclonal antibody

TRAPPC2L polyclonal antibody

Ref: AB-PAB23843
TRAPPC2L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TRAPPC2L.
Información adicional
Size 100 uL
Gene Name TRAPPC2L
Gene Alias HSPC176|MGC111156
Gene Description trafficking protein particle complex 2-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKALVDQRELYLGLLYPTEDYKVYG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TRAPPC2L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51693
Iso type IgG

Enviar uma mensagem


TRAPPC2L polyclonal antibody

TRAPPC2L polyclonal antibody