ARHGAP17 polyclonal antibody
  • ARHGAP17 polyclonal antibody

ARHGAP17 polyclonal antibody

Ref: AB-PAB23842
ARHGAP17 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARHGAP17.
Información adicional
Size 100 uL
Gene Name ARHGAP17
Gene Alias DKFZp564A1363|FLJ37567|FLJ43368|MGC87805|MST066|MST110|MSTP038|MSTP066|MSTP110|NADRIN|RICH1|WBP15
Gene Description Rho GTPase activating protein 17
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KQLARLVLDWDSVRARWNQAHKSSGTNFQGLPSKIDTLKEEMDEAGNKVEQCKDQLAADMYNFMAKEGEYGKFFVTLLEA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ARHGAP17.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55114
Iso type IgG

Enviar uma mensagem


ARHGAP17 polyclonal antibody

ARHGAP17 polyclonal antibody