SLC26A1 polyclonal antibody
  • SLC26A1 polyclonal antibody

SLC26A1 polyclonal antibody

Ref: AB-PAB23838
SLC26A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC26A1.
Información adicional
Size 100 uL
Gene Name SLC26A1
Gene Alias EDM4|SAT-1|SAT1
Gene Description solute carrier family 26 (sulfate transporter), member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DTAFYEDATEFEGLVPEPGVRVFRFGGPLYYANKDFFLRSLYSLTGLDAGCMAARRKEGGSETGVGEGGP
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC26A1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10861
Iso type IgG

Enviar uma mensagem


SLC26A1 polyclonal antibody

SLC26A1 polyclonal antibody