FCHO1 polyclonal antibody
  • FCHO1 polyclonal antibody

FCHO1 polyclonal antibody

Ref: AB-PAB23837
FCHO1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FCHO1.
Información adicional
Size 100 uL
Gene Name FCHO1
Gene Alias KIAA0290
Gene Description FCH domain only 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GAKAFRLPGLSRREREPEPPAAVDFLEPDSGTCPEVDEEGFTVRPDVTQNSTAEPSRFSSSDSDFDDEEPRKFYVHIKPA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FCHO1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23149
Iso type IgG

Enviar uma mensagem


FCHO1 polyclonal antibody

FCHO1 polyclonal antibody