POU1F1 polyclonal antibody
  • POU1F1 polyclonal antibody

POU1F1 polyclonal antibody

Ref: AB-PAB23836
POU1F1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant POU1F1.
Información adicional
Size 100 uL
Gene Name POU1F1
Gene Alias GHF-1|PIT1|Pit-1
Gene Description POU class 1 homeobox 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq CKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAE
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human POU1F1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5449
Iso type IgG

Enviar uma mensagem


POU1F1 polyclonal antibody

POU1F1 polyclonal antibody