EVX2 polyclonal antibody
  • EVX2 polyclonal antibody

EVX2 polyclonal antibody

Ref: AB-PAB23830
EVX2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EVX2.
Información adicional
Size 100 uL
Gene Name EVX2
Gene Alias -
Gene Description even-skipped homeobox 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PLHSALGELPAKGKFEIDTLFNLQHTGSESTVSSEISSAAESRKKPGHYS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EVX2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 344191
Iso type IgG

Enviar uma mensagem


EVX2 polyclonal antibody

EVX2 polyclonal antibody