FAM169A polyclonal antibody
  • FAM169A polyclonal antibody

FAM169A polyclonal antibody

Ref: AB-PAB23829
FAM169A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM169A.
Información adicional
Size 100 uL
Gene Name FAM169A
Gene Alias KIAA0888
Gene Description family with sequence similarity 169, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq QPFNSSEDSTNLVPLVVESSKPPEVDAPDKTPRIPDSEMLMDEGTSDEKGHMEEKLSLLPRKKAHLGSSDNVATMSNEERSDGGFPNSVIAEFSEEP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM169A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26049
Iso type IgG

Enviar uma mensagem


FAM169A polyclonal antibody

FAM169A polyclonal antibody