CCDC86 polyclonal antibody
  • CCDC86 polyclonal antibody

CCDC86 polyclonal antibody

Ref: AB-PAB23824
CCDC86 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC86.
Información adicional
Size 100 uL
Gene Name CCDC86
Gene Alias FLJ22321|MGC2574
Gene Description coiled-coil domain containing 86
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq LQQGAGLESPQGQPEPGAASPQRQQDLHLESPQRQPEYSPESPRCQPKPSEEAPKCSQDQGVLASELAQNKEELTPGAPQHQLPPV
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC86.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79080
Iso type IgG

Enviar uma mensagem


CCDC86 polyclonal antibody

CCDC86 polyclonal antibody