SLC7A6OS polyclonal antibody
  • SLC7A6OS polyclonal antibody

SLC7A6OS polyclonal antibody

Ref: AB-PAB23823
SLC7A6OS polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC7A6OS.
Información adicional
Size 100 uL
Gene Name SLC7A6OS
Gene Alias FLJ13291
Gene Description solute carrier family 7, member 6 opposite strand
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AEALVLACKRLRSDAVESAAQKTSEGLERAAENNVFHLVATVCSQEEPVQPLLREVLRPSRDSQQRVRRNLRASAREVRQEGRYRVLS
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC7A6OS.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84138
Iso type IgG

Enviar uma mensagem


SLC7A6OS polyclonal antibody

SLC7A6OS polyclonal antibody