FAM96B polyclonal antibody
  • FAM96B polyclonal antibody

FAM96B polyclonal antibody

Ref: AB-PAB23816
FAM96B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM96B.
Información adicional
Size 100 uL
Gene Name FAM96B
Gene Alias CGI-128
Gene Description family with sequence similarity 96, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq LIYQRSGERPVTAGEEDEQVPDSIDAREIFDLIRSINDPEHPLTLEELNVVEQVRVQVSDPESTVAVAFTPTIP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM96B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51647
Iso type IgG

Enviar uma mensagem


FAM96B polyclonal antibody

FAM96B polyclonal antibody