CCDC153 polyclonal antibody
  • CCDC153 polyclonal antibody

CCDC153 polyclonal antibody

Ref: AB-PAB23815
CCDC153 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC153.
Información adicional
Size 100 uL
Gene Name CCDC153
Gene Alias MGC125447|MGC125448
Gene Description coiled-coil domain containing 153
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq REEAEQALGERDQALAQLRAHMADMEAKYEEILHDSLDRLLAKLRAIKQQWDGAALRLHARHKEQQRQFGLTPPGSLRPPAPSL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC153.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 283152
Iso type IgG

Enviar uma mensagem


CCDC153 polyclonal antibody

CCDC153 polyclonal antibody