C16orf48 polyclonal antibody
  • C16orf48 polyclonal antibody

C16orf48 polyclonal antibody

Ref: AB-PAB23811
C16orf48 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C16orf48.
Información adicional
Size 100 uL
Gene Name C16orf48
Gene Alias DAKV6410|DKFZp434A1319
Gene Description chromosome 16 open reading frame 48
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq QVLAQVLEQQRQAQEHYNATQKGHVPHYLLERRDLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C16orf48.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84080
Iso type IgG

Enviar uma mensagem


C16orf48 polyclonal antibody

C16orf48 polyclonal antibody