POLR3E polyclonal antibody
  • POLR3E polyclonal antibody

POLR3E polyclonal antibody

Ref: AB-PAB23810
POLR3E polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant POLR3E.
Información adicional
Size 100 uL
Gene Name POLR3E
Gene Alias RPC5|SIN
Gene Description polymerase (RNA) III (DNA directed) polypeptide E (80kD)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq FVMWKFTQSRWVVRKEVATVTKLCAEDVKDFLEHMAVVRINKGWEFILPYDGEFIKKHPDVVQRQHMLWTGIQAKLEKVYNLVKETMPKKPDAQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human POLR3E.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55718
Iso type IgG

Enviar uma mensagem


POLR3E polyclonal antibody

POLR3E polyclonal antibody