TIGD7 polyclonal antibody
  • TIGD7 polyclonal antibody

TIGD7 polyclonal antibody

Ref: AB-PAB23809
TIGD7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TIGD7.
Información adicional
Size 100 uL
Gene Name TIGD7
Gene Alias Sancho
Gene Description tigger transposable element derived 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HGDYREILEKCGELETKLDDDRVWLNGDEEKGCLLKTKGGITKEVVQKGGEAEKQTAEFKLSAVRESLDYLLDFVDATPEF
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TIGD7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 91151
Iso type IgG

Enviar uma mensagem


TIGD7 polyclonal antibody

TIGD7 polyclonal antibody