PLEKHG6 polyclonal antibody
  • PLEKHG6 polyclonal antibody

PLEKHG6 polyclonal antibody

Ref: AB-PAB23806
PLEKHG6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PLEKHG6.
Información adicional
Size 100 uL
Gene Name PLEKHG6
Gene Alias FLJ10665|MGC126315|MGC126353|MGC126354|MyoGEF
Gene Description pleckstrin homology domain containing, family G (with RhoGef domain) member 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GLLMEVSAETLFGNVPSLIRTHRSFWDEVLGPTLEETRASGQPLDPIGLQSGFLTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCE
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PLEKHG6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55200
Iso type IgG

Enviar uma mensagem


PLEKHG6 polyclonal antibody

PLEKHG6 polyclonal antibody